Novus Biologicals
Manufacturer Code:NBP230906
Catalog # NBP230906
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: b3Gal-T5 B3GalTx Beta-13-GalTase 5 Beta3GalT5 Beta3Gal-T5 EC 2.4.1 EC 2.4.1.- UDP-Gal:betaGlcNAc beta 13-galactosyltransferase polypeptide 510Beta-3-Gx-T5 UDP-Gal:beta-GlcNAc beta-13-galactosyltransferase 5 UDP-galactose:beta-N-acetylglucosamine beta-13-galactosyltransferase 5; Beta-1,3-galactosyltransferase 5; Beta-1,3-GalTase 5; beta-3-galactosyltransferase 5; Beta-3-Gx-T5; homolog of C. elegans Bt toxin resistance gene bre-5; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
Gene Aliases: B3GalT-V; B3GALT5; B3GalTx; B3T5; beta-1,3-GalTase 5; beta-3-Gx-T5; beta3Gal-T5; GLCT5
UniProt ID: (Human) Q9Y2C3
Entrez Gene ID: (Human) 10317
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.