Novus Biologicals
Manufacturer Code:NBP15793020UL
Catalog # NBP15793020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to B3GALNT2(beta-13-N-acetylgalactosaminyltransferase 2) The peptide sequence was selected from the middle region of B3GALNT2. Peptide sequence PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B3GalNAc-T2 beta 13-N-acetylgalactosaminyltransferase-II (MGC39558) beta-13-galactosaminyltransferase 2 Beta-13-GalNAc-T2 beta-13-N-acetylgalactosaminyltransferase 2 Beta-13-N-acetylgalactosaminyltransferase II EC 2.4.1 EC 2.4.1.- MGC39558 UDP-GalNAc:beta-13-N-acetylgalactosaminyltransferase 2 UDP-GalNAc:betaGlcNAc beta 13-galactosaminyltransferase polypeptide 2 UDP-GalNAc:betaGlcNAc beta-13-galactosaminyltransferase polypeptide 2; Beta-1,3-GalNAc-T2; Beta-1,3-N-acetylgalactosaminyltransferase II; UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2; UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2
Gene Aliases: B3GalNAc-T2; B3GALNT2; MDDGA11
UniProt ID: (Human) Q8NCR0
Entrez Gene ID: (Human) 148789
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.