Novus Biologicals
Manufacturer Code:NBP242186UV
Catalog # NBP242186UV
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Mouse |
Class | Monoclonal |
Type | Antibody |
Clone | S76-8 |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Conjugate | DyLight 350 |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C in the dark. |
Mouse Monoclonal Antibody
Protein Aliases: alternative ataxin1; ataxin 1 ataxin 1) ataxin-1 ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1 autosomal dominant SCA1D6S504E Spinocerebellar ataxia type 1 protein; Ataxin-1; Spinocerebellar ataxia type 1 protein
Gene Aliases: ATX1; ATXN1; D6S504E; SCA1
UniProt ID: (Human) P54253
Entrez Gene ID: (Human) 6310
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.