Novus Biologicals
Manufacturer Code:NBP154778
Catalog # NBP154778
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1 soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: aspartate aminotransferase 1; aspartate aminotransferase cytoplasmic EC 2.6.1.1 GIG18 Glutamate oxaloacetate transaminase 1 glutamic-oxaloacetic transaminase 1 soluble (aspartate aminotransferase 1) growth-inhibiting protein 18 Transaminase A; Aspartate aminotransferase, cytoplasmic; aspartate transaminase 1; cAspAT; cCAT; Cysteine aminotransferase, cytoplasmic; Cysteine transaminase, cytoplasmic; Glutamate oxaloacetate transaminase 1; glutamic-oxaloacetic transaminase 1, soluble; growth-inhibiting protein 18; testis secretory sperm-binding protein Li 196a; Transaminase A
Gene Aliases: AST1; ASTQTL1; cAspAT; cCAT; GIG18; GOT1
UniProt ID: (Human) P17174
Entrez Gene ID: (Human) 2805
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.