Novus Biologicals
Manufacturer Code:NBP154888
Catalog # NBP154888
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ASGR2 (asialoglycoprotein receptor 2) The peptide sequence was selected from the N terminal of ASGR2. Peptide sequence STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ASGP-R 2; ASGPR 2 ASGP-R 2 ASGPR2 ASGP-R2 asialoglycoprotein receptor 2 CLEC4H2FLJ60040 C-type lectin domain family 4 member H2 HBxAg-binding protein HBXBP Hepatic lectin H2 HL-2; Asialoglycoprotein receptor 2; C-type lectin domain family 4 member H2; HBxAg-binding protein; Hepatic lectin H2; HL-2
Gene Aliases: ASGP-R2; ASGPR2; ASGR2; CLEC4H2; HBXBP; HL-2
UniProt ID: (Human) P07307
Entrez Gene ID: (Human) 433
Molecular Function: cell adhesion molecule cytokine receptor defense/immunity protein immunoglobulin receptor superfamily receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.