Novus Biologicals
Manufacturer Code:NBP16908320UL
Catalog # NBP16908320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ARR3 (arrestin 3 retinal (X-arrestin)) The peptide sequence was selected from the middle region of ARR3. Peptide sequence EDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: arrestin 3 retinal (X-arrestin); arrestin 3 retinal (X-arrestin) arrestin 4 arrestin-C ARRXcArr CAR C-arrestin Cone arrestin Retinal cone arrestin-3 X-arrestin; arrestin 4; Arrestin-C; C-arrestin; Cone arrestin; Retinal cone arrestin-3; X-arrestin
Gene Aliases: ARR3; ARRX; CAR; cArr
UniProt ID: (Human) P36575
Entrez Gene ID: (Human) 407
Molecular Function:
enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.