Novus Biologicals
Manufacturer Code:NBP170403
Catalog # NBP170403
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADC (arginine decarboxylase) The peptide sequence was selected from the middle region of ADC)(50ug). Peptide sequence RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADC; Antizyme inhibitor 2; antizyme inhibitor 2 ARGDC arginine decarboxylase AZI2 KIAA1945 ODC antizyme inhibitor-2 ODC1L ODC-p ODC-paralogue ornithine decarboxylase-like protein ornithine decarboxylase-paralog; Arginine decarboxylase; AzI2; ODC antizyme inhibitor-2; ODC-like protein; ODC-p; ODC-paralogue; ornithine decarboxylase like; ornithine decarboxylase paralog; Ornithine decarboxylase-like protein; ornithine decarboxylase-paralog
Gene Aliases: ADC; AZI2; AZIB1; AZIN2; KIAA1945; ODC-p; ODC1L; ODCP
UniProt ID: (Human) Q96A70
Entrez Gene ID: (Human) 113451
Molecular Function: decarboxylase lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.