Novus Biologicals
Manufacturer Code:NBP15438420UL
Catalog # NBP15438420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AQP7 (aquaporin 7) The peptide sequence was selected from the C terminal of AQP7. Peptide sequence DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AQP-7; AQP-7 AQP7L AQP9MGC149556 AQPapaquaglyceroporin-7 Aquaglyceroporin-7 aquaporin 7 Aquaporin adipose aquaporin-7 Aquaporin-7-like MGC149555; AQPap; Aquaglyceroporin-7; Aquaporin adipose; Aquaporin-7; Aquaporin-7-like
Gene Aliases: AQP7; AQP7L; AQP9; AQPap; GLYCQTL
UniProt ID: (Human) O14520
Entrez Gene ID: (Human) 364
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.