Invitrogen
Manufacturer Code:PA577709
Catalog # PIPA577709
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Frozen) (IHC (F)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV corresponding to amino acid residues 249-323 of rat AQP4 |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | -20°C |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AQP-4; Aquaporin 4; aquaporin type4; Aquaporin-4; Mercurial-insensitive water channel; MIWC; WCH4
Gene Aliases: AQP-4; AQP4; MIWC; MIWC2; WCH4
UniProt ID: (Human) P55087, (Mouse) P55088, (Rat) P47863
Entrez Gene ID: (Human) 361, (Mouse) 11829, (Rat) 25293
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.