Novus Biologicals
Manufacturer Code:NBP233472
Catalog # NBP233472
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADH water channel; ADH water channel AQP-2 AQP-CD aquaporin 2 (collecting duct) aquaporin-2 aquaporin-CD Collecting duct water channel protein MGC34501 Water channel protein for renal collecting duct water-channel aquaporin 2 WCH-CD; AQP-2; AQP-CD; aquaporin 2 (collecting duct); Aquaporin-2; Aquaporin-CD; Collecting duct water channel protein; Water channel protein for renal collecting duct; water-channel aquaporin 2; WCH-CD
Gene Aliases: AQP-CD; AQP2; WCH-CD
UniProt ID: (Human) P41181
Entrez Gene ID: (Human) 359
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.