Novus Biologicals
Manufacturer Code:NBP162621
Catalog # NBP162621
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AQP10(aquaporin 10) The peptide sequence was selected from the middle region of AQP10 (NP_536354). Peptide sequence VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AQP-10; AQP-10 AQPA_HUMAN Aquaglyceroporin-10 aquaporin 10 aquaporin-10 Small intestine aquaporin; Aquaglyceroporin-10; Aquaporin-10; Small intestine aquaporin
Gene Aliases: AQP10; AQPA_HUMAN
UniProt ID: (Human) Q96PS8
Entrez Gene ID: (Human) 89872
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.