Novus Biologicals
Manufacturer Code:NBP15771620UL
Catalog # NBP15771620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Apo-AII; APOA2 apoAII Apo-AII ApoA-II Apolipoprotein A2 apolipoprotein A-II; Apolipoprotein A-II; Apolipoprotein A-II(1-76); Apolipoprotein A2; ProapoA-II; Proapolipoprotein A-II; Truncated apolipoprotein A-II
Gene Aliases: Apo-AII; ApoA-II; APOA2; apoAII
UniProt ID: (Human) P02652
Entrez Gene ID: (Human) 336
Molecular Function:
apolipoprotein
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.