Novus Biologicals
Manufacturer Code:NBP159124
Catalog # NBP159124
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ANXA2 (annexin A2) The peptide sequence was selected from the C terminal of ANXA2 (NP_004030). Peptide sequence: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Annexin A2; annexin A2 Annexin II annexin-2 ANX2 ANX2L4LPC2 CAL1H Calpactin I heavy chain calpactin I heavy polypeptide Calpactin-1 heavy chain chromobindin 8 Chromobindin-8 LIP2PAP-IV Lipocortin II LPC2DP36 p36 Placental anticoagulant protein IV Protein I; Annexin II; Annexin-2; Calpactin I heavy chain; calpactin I heavy polypeptide; Calpactin-1 heavy chain; chromobindin 8; Chromobindin-8; epididymis secretory protein Li 270; Lipocortin II; p36; PAP-IV; Placental anticoagulant protein IV; Protein I
Gene Aliases: ANX2; ANX2L4; ANXA2; CAL1H; HEL-S-270; LIP2; LPC2; LPC2D; P36; PAP-IV
UniProt ID: (Human) P07355
Entrez Gene ID: (Human) 302
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.