Novus Biologicals
Manufacturer Code:NBP159175
Catalog # NBP159175
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ANXA1 (annexin A1) The peptide sequence was selected from the N terminal of ANXA1. Peptide sequence WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: Annexin A1; annexin A1 Annexin I annexin I (lipocortin I) Annexin-1 ANX1 Calpactin II calpactin-2 Chromobindin-9 Lipocortin I LPC1annexin-1 p35 Phospholipase A2 inhibitory protein; Annexin I; annexin I (lipocortin I); Annexin-1; Calpactin II; Calpactin-2; Chromobindin-9; Lipocortin I; p35; Phospholipase A2 inhibitory protein
Gene Aliases: ANX1; ANXA1; LPC1
UniProt ID: (Human) P04083
Entrez Gene ID: (Human) 301
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.