Novus Biologicals
Manufacturer Code:NBP15476620UL
Catalog # NBP15476620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AMT(aminomethyltransferase) The peptide sequence was selected from the N terminal of AMT. Peptide sequence QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: aminomethyltransferase EC 2.1.2.10 GCE GCSTaminomethyltransferase (glycine cleavage system protein T) glycine cleavage system protein T NKHmitochondrial; Aminomethyltransferase, mitochondrial; GCVT; Glycine cleavage system T protein
Gene Aliases: AMT; GCE; GCST; GCVT; NKH
UniProt ID: (Human) P48728
Entrez Gene ID: (Human) 275
Molecular Function:
dehydrogenase
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.