Novus Biologicals
Manufacturer Code:NBP155292
Catalog # NBP155292
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACTN3(actinin alpha 3) The peptide sequence was selected from the N terminal of ACTN3. Peptide sequence VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: actinin alpha 3 alpha-actinin skeletal muscle Alpha-actinin skeletal muscle isoform 3 alpha-actinin-3 F-actin cross-linking protein MGC117002 MGC117005; actinin, alpha 3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; Alpha-actinin-3; F-actin cross-linking protein
Gene Aliases: ACTN3
UniProt ID: (Human) Q08043
Entrez Gene ID: (Human) 89
Molecular Function: actin family cytoskeletal protein cytoskeletal protein non-motor actin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.