Novus Biologicals
Manufacturer Code:NBP19132320UL
Catalog # NBP19132320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human ALDOC. Peptide sequence CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ALDC aldolase 3 aldolase C fructose-bisphosphate Brain-type aldolase EC 4.1.2.13 fructoaldolase C fructose-16-biphosphate triosephosphate lyase fructose-bisphosphate aldolase C; aldolase 3; aldolase C, fructose-bisphosphate; Brain-type aldolase; fructoaldolase C; fructose-1,6-biphosphate triosephosphate lyase; Fructose-bisphosphate aldolase C
Gene Aliases: ALDC; ALDOC
UniProt ID: (Human) P09972
Entrez Gene ID: (Human) 230
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.