Novus Biologicals
Manufacturer Code:NBP16887720UL
Catalog # NBP16887720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 20 alpha-hydroxysteroid dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase 20-ALPHA-HSD 20-alpha-hydroxysteroid dehydrogenase aldo-keto reductase family 1 member C1 aldo-keto reductase family 1 member C1 (dihydrodiol dehydrogenase 1 20-alpha(3-alpha)-hydroxysteroid dehydrogenase) C9 Chlordecone reductase homolog HAKRC DD1/DD2 DD1MGC8954 DDHH-37 dihydrodiol dehydrogenase 1 Dihydrodiol dehydrogenase 1/2 dihydrodiol dehydrogenase isoform DD1 EC 1.1.1 EC 1.1.1.- EC 1.1.1.112 EC 1.1.1.1492-ALPHA-HSD EC 1.3.1.20 HAKRCDDH1aldo-keto reductase C HBAB hepatic dihydrodiol dehydrogenase High-affinity hepatic bile acid-binding protein Indanol dehydrogenase MBAB Trans-12-dihydrobenzene-12-diol dehydrogenase type II 3-alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; 20-alpha-hydroxysteroid dehydrogenase; aldo-keto reductase C; Aldo-keto reductase family 1 member C1; Chlordecone reductase homolog HAKRC; DD1; Dihydrodiol dehydrogenase 1; dihydrodiol dehydrogenase 1/2; dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase; dihydrodiol dehydrogenase isoform DD1; HBAB; hepatic dihydrodiol dehydrogenase; High-affinity hepatic bile acid-binding protein; indanol dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; type II 3-alpha-hydroxysteroid dehydrogenase
Gene Aliases: 2-ALPHA-HSD; 20-ALPHA-HSD; AKR1C1; C9; DD1; DD1/DD2; DDH; DDH1; H-37; HAKRC; HBAB; MBAB
UniProt ID: (Human) Q04828
Entrez Gene ID: (Human) 1645
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.