Novus Biologicals
Manufacturer Code:NBP189161
Catalog # NBP189161
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AKR1B11 AKR1B12 aldo-keto reductase family 1 member B10 aldo-keto reductase family 1 member B10 (aldose reductase) aldo-keto reductase family 1 member B11 (aldose reductase-like) Aldose reductase-like aldose reductase-like 1 aldose reductase-like peptide Aldose reductase-related protein ALDRLn ARL1 ARL-1SI reductase ARP EC 1.1.1 EC 1.1.1.- EC 1.1.1.21 hARP HIS HSI MGC14103 Small intestine reductase; Aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); Aldose reductase-like; aldose reductase-like 1; aldose reductase-like peptide; Aldose reductase-related protein; ARL-1; ARP; hARP; SI reductase; Small intestine reductase
Gene Aliases: AKR1B10; AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
UniProt ID: (Human) O60218
Entrez Gene ID: (Human) 57016
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.