Novus Biologicals
Manufacturer Code:NBP247551
Catalog # NBP247551
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Aldehyde dehydrogenase 3; Aldehyde dehydrogenase 3 aldehyde dehydrogenase 3 family member A1 Aldehyde dehydrogenase family 3 member A1 aldehyde dehydrogenase isozyme 3 aldehyde dehydrogenase type III ALDH3aldehyde dehydrogenase dimeric NADP-preferring ALDHIII EC 1.2.1 EC 1.2.1.5 MGC10406 stomach aldehyde dehydrogenase; aldehyde dehydrogenase 3 family, member A1; Aldehyde dehydrogenase family 3 member A1; aldehyde dehydrogenase isozyme 3; aldehyde dehydrogenase type III; Aldehyde dehydrogenase, dimeric NADP-preferring; ALDHIII; stomach aldehyde dehydrogenase
Gene Aliases: ALDH3; ALDH3A1; ALDHIII
UniProt ID: (Human) P30838
Entrez Gene ID: (Human) 218
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.