Novus Biologicals
Manufacturer Code:NBP234094
Catalog # NBP234094
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPEGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3; acylglycerol O-acyltransferase; Acylglycerol O-acyltransferase adiponutrin ADPNdJ796I17.1 C22orf20 Calcium-independent phospholipase A2-epsilon chromosome 22 open reading frame 20 EC 2.3.1.- EC 2.7.7.56 EC 3.1.1.3 EC 4.2.3.4 FLJ22012 iPLA(2)epsilon iPLA2-epsilon patatin-like phospholipase domain containing 3 patatin-like phospholipase domain-containing protein 3; Acylglycerol transacylase; Adiponutrin; ADPN; Calcium-independent phospholipase A2-epsilon; iPLA2-epsilon; iPLA2epsilon; Lysophosphatidic acid acyltransferase; patatin-like phospholipase domain containing 3; Patatin-like phospholipase domain-containing protein 3
Gene Aliases: ADPN; C22orf20; iPLA(2)epsilon; PNPLA3
UniProt ID: (Human) Q9NST1
Entrez Gene ID: (Human) 80339
Molecular Function: acyltransferase hydrolase lipase phospholipase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.