Novus Biologicals
Manufacturer Code:NBP159023
Catalog # NBP159023
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADCY6(adenylate cyclase 6) The peptide sequence was selected from the C terminal of ADCY6 (NP_066193). Peptide sequence LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AC6 adenylate cyclase 6 adenylate cyclase type 6 Adenylate cyclase type VI Adenylyl cyclase 6 ATP pyrophosphate-lyase 6 Ca(2+)-inhibitable adenylyl cyclase DKFZp779F075 EC 4.6.1.1 KIAA0422; Adenylate cyclase type 6; Adenylate cyclase type VI; Adenylyl cyclase 6; ATP pyrophosphate-lyase 6; Ca(2+)-inhibitable adenylyl cyclase
Gene Aliases: AC6; ADCY6; KIAA0422; LCCS8
UniProt ID: (Human) O43306
Entrez Gene ID: (Human) 112
Molecular Function: adenylate cyclase cyclase guanylate cyclase lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.