Novus Biologicals
Manufacturer Code:NBP191647
Catalog # NBP191647
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: activin A receptor type II activin A receptor type IIA Activin receptor type IIA activin receptor type-2A ACTRII ACTRIIA ACVR2ACTR-IIA EC 2.7.11 EC 2.7.11.30; activin A receptor type IIA; activin A receptor, type IIA; Activin receptor type IIA; Activin receptor type-2A; ACTR-IIA
Gene Aliases: ACTRII; ACVR2; ACVR2A
UniProt ID: (Human) P27037
Entrez Gene ID: (Human) 92
Molecular Function:
TGF-beta receptor
cytokine receptor
kinase
protein kinase
protein kinase receptor
receptor
serine/threonine protein kinase receptor
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.