Novus Biologicals
Manufacturer Code:NBP239003
Catalog # NBP239003
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: activin A receptor type IB; activin A receptor type IB Activin receptor type IB Activin receptor-like kinase 4 ACTRIB ACVRLK4ACTR-IB ALK-4 ALK4activin A receptor type II-like kinase 4 EC 2.7.11 EC 2.7.11.30 Serine/threonine-protein kinase receptor R2 SKR2activin receptor type-1B; activin A receptor, type IB; activin A receptor, type II-like kinase 4; Activin receptor type IB; Activin receptor type-1B; Activin receptor-like kinase 4; ACTR-IB; ALK-4; Serine/threonine-protein kinase receptor R2; SKR2
Gene Aliases: ACTRIB; ACVR1B; ACVRLK4; ALK4; SKR2
UniProt ID: (Human) P36896
Entrez Gene ID: (Human) 91
Molecular Function: TGF-beta receptor cytokine receptor kinase protein kinase protein kinase receptor receptor serine/threonine protein kinase receptor transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.