Novus Biologicals
Manufacturer Code:NBP187677
Catalog # NBP187677
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Aconitase; aconitase 1, soluble; Aconitase aconitase 1 soluble aconitate hydratase Citrate hydro-lyase cytoplasmic aconitate hydratase EC 4.2.1 EC 4.2.1.3 Ferritin repressor protein IREB1IREBP1 IREBP IRE-BP 1 Iron regulatory protein 1 iron-responsive element binding protein 1 Iron-responsive element-binding protein 1 IRP1ACONS; aconitate hydratase, cytoplasmic; Citrate hydro-lyase; Cytoplasmic aconitate hydratase; cytosplasmic aconitase; epididymis luminal protein 60; Ferritin repressor protein; IRE-BP 1; Iron regulatory protein 1; iron-responsive element binding protein 1; Iron-responsive element-binding protein 1; IRP1; soluble aconitase
Gene Aliases: ACO1; ACONS; HEL60; IREB1; IREBP; IREBP1; IRP1
UniProt ID: (Human) P21399
Entrez Gene ID: (Human) 48
Molecular Function: dehydratase hydratase lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.