Novus Biologicals
Manufacturer Code:NBP168944
Catalog # NBP168944
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CNN3 (calponin 3 acidic) The peptide sequence was selected from the C terminal of CNN3. Peptide sequence GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calponin 3 acidic Calponin acidic isoform calponin-3 dJ639P13.2.2 (acidic calponin 3); calponin 3, acidic; Calponin, acidic isoform; Calponin-3; dJ639P13.2.2 (acidic calponin 3)
Gene Aliases: CNN3
UniProt ID: (Human) Q15417
Entrez Gene ID: (Human) 1266
Molecular Function:
actin family cytoskeletal protein
cytoskeletal protein
non-motor actin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.