Novus Biologicals
Manufacturer Code:NBP17944820UL
Catalog # NBP17944820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Fruit fly |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The specific Immunogen is proprietary information. Peptide sequence FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 990 E5 F1 Ac ac achaete Ac/Sc ASC AS-C T5 AS-C T5ac ascT5 CG3796 DmelCG3796 EG:125H10.3 Hw sc/T5 T5; ac-PA; achaete-scute; Achaete-scute complex protein T5; Achaete/Scute; acheate; achete; asc; CG3796-PA; hairy wing; Hairy-wing; IP01413p; Protein achaete
Gene Aliases: 990 E5 F1; AC; AS-C; AS-C T5; AS-C T5ac; ASC; ascT5; CG3796; Dmel\CG3796; Dmel_CG3796; EG:125H10.3; Hw; sc/T5; T5
UniProt ID: (Fruit fly) P10083
Entrez Gene ID: (Fruit fly) 30981
Molecular Function: basic helix-loop-helix transcription factor nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.