Novus Biologicals
Manufacturer Code:NBP198507
Catalog # NBP198507
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is acetoacetyl CoA synthetase - N-terminal region. Peptide sequence MFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: acetoacetate-CoA ligase; acetoacetate-CoA ligase acetoacetyl-CoA synthetase ACSF1FLJ41251 Acyl-CoA synthetase family member 1 EC 6.2.1 EC 6.2.1.16 FLJ12389 homolog of C. elegans supressor of ras 5 (sur-5) Protein sur-5 homolog SUR-5; Acetoacetyl-CoA synthetase; Acyl-CoA synthetase family member 1; homolog of C. elegans supressor of ras 5 (sur-5); Protein sur-5 homolog
Gene Aliases: AACS; ACSF1; SUR-5
UniProt ID: (Human) Q86V21
Entrez Gene ID: (Human) 65985
Molecular Function: dehydrogenase ligase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.