Novus Biologicals
Manufacturer Code:NBP155458
Catalog # NBP155458
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ABHD5(abhydrolase domain containing 5) The peptide sequence was selected from the N terminal of ABHD5 (NP_057090). Peptide sequence NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerol-3-phosphate O-acyltransferase ABHD5; abhydrolase domain containing 5 Abhydrolase domain-containing protein 51-acylglycerol-3-phosphate O-acyltransferase ABHD5 CDS CGI58 EC 2.3.1.51 IECN2 Lipid droplet-binding protein CGI-58 MGC8731 NCIE2CGI-58; Abhydrolase domain-containing protein 5; Lipid droplet-binding protein CGI-58; truncated abhydrolase domain-containing protein 5
Gene Aliases: ABHD5; CDS; CGI-58; CGI58; IECN2; NCIE2
UniProt ID: (Human) Q8WTS1
Entrez Gene ID: (Human) 51099
Molecular Function:
hydrolase
protease
serine protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.