Novus Biologicals
Manufacturer Code:NBP238003
Catalog # NBP238003
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 11-cis-RE-synthase; 11-cis-specific retinyl-ester synthase; Acyl-CoA retinol O-fatty-acyltransferase; Acyl-CoA wax alcohol acyltransferase 2; ARAT; Diacylglycerol O-acyltransferase 2-like protein 4; Diacylglycerol O-acyltransferase candidate 4; hDC4; hWS; Long-chain-alcohol O-fatty-acyltransferase 2; Multifunctional O-acyltransferase; retinol O-fatty-acyltransferase; Wax synthase
Gene Aliases: ARAT; AWAT2; DC4; DGAT2L4; MFAT; WS
UniProt ID: (Human) Q6E213
Entrez Gene ID: (Human) 158835
Molecular Function: acyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.