Novus Biologicals
Manufacturer Code:NBP159865
Catalog # NBP159865
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AWAT1 (acyl-CoA wax alcohol acyltransferase 1) Antibody(against the N terminal of AWAT1. Peptide sequence NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyl-CoA wax alcohol acyltransferase 1; acyl-CoA wax alcohol acyltransferase 1 DGA2 DGAT2L3 diacyl-glycerol acyltransferase 2 Diacylglycerol acyltransferase 2 diacylglycerol O-acyltransferase 2-like 3 Diacylglycerol O-acyltransferase 2-like protein 3 EC 2.3.1.75 Long-chain-alcohol O-fatty-acyltransferase 1; diacyl-glycerol acyltransferase 2; Diacylglycerol acyltransferase 2; diacylglycerol O-acyltransferase 2-like 3; Diacylglycerol O-acyltransferase 2-like protein 3; Long-chain-alcohol O-fatty-acyltransferase 1
Gene Aliases: AWAT1; DGA2; DGAT2L3
UniProt ID: (Human) Q5JT21
Entrez Gene ID: (Human) 158833
Molecular Function: acyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.