Novus Biologicals
Manufacturer Code:NBP276547
Catalog # NBP276547
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
Protein Aliases: ataxia telangiectasia and Rad3 related Ataxia telangiectasia and Rad3-related protein EC 2.7.11.1 FRAP-related protein 1 FRP1FRAP-related protein-1 MEC1 protein kinase ATR Rad3 related protein SCKL1 SCKLMEC1 mitosis entry checkpoint 1 homolog serine/threonine-protein kinase ATR; Ataxia telangiectasia and Rad3-related protein; FRAP-related protein 1; FRAP-related protein-1; MEC1, mitosis entry checkpoint 1, homolog; Serine/threonine-protein kinase ATR
Gene Aliases: ATR; FCTCS; FRP1; MEC1; SCKL; SCKL1
UniProt ID: (Human) Q13535
Entrez Gene ID: (Human) 545
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
nucleic acid binding
nucleotide kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.