Novus Biologicals
Manufacturer Code:NBP179284
Catalog # NBP179284
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human ATPIF1. Peptide sequence GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP synthase F1 subunit epsilon; ATP synthase inhibitor protein; ATP synthase inhibitor protein ATPase inhibitor protein ATPase inhibitor mitochondrial ATPase inhibitory factor 1 ATPIIF(1) ATPIP IF1 Inhibitor of F(1)F(o)-ATPase IP MGC1167 MGC8898; ATPase inhibitor protein; ATPase inhibitor, mitochondrial; IF(1); IF1; Inhibitor of F(1)F(o)-ATPase
Gene Aliases: ATP5IF1; ATPI; ATPIF1; ATPIP; IP
UniProt ID: (Human) Q9UII2
Entrez Gene ID: (Human) 93974
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.