Novus Biologicals
Manufacturer Code:NBP15485820UL
Catalog # NBP15485820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ATP6V1B2(ATPase H+ transporting lysosomal 56/58kDa V1 subunit B2) The peptide sequence was selected from the middle region of ATP6V1B2. Peptide sequence NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 000 subunit 56/58kD isoform 2 ATP6B2ATPase H+ transporting lysosomal (vacuolar proton pump) beta polypeptide ATPase H+ transporting lysosomal 56/58kDa V1 subunit B2 Endomembrane proton pump 58 kDa subunit H+ transporting two-sector ATPase HO57ATP6B1B2 vacuolar H+-ATPase 56 Vacuolar proton pump subunit B 2 VATB V-ATPase B2 subunit V-ATPase subunit B 2 Vma2 VPP3ATPase H+ transporting lysosomal 56/58kDa V1 subunit B isoform 2 V-type proton ATPase subunit B brain isoform; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2; Endomembrane proton pump 58 kDa subunit; H+ transporting two-sector ATPase; HO57; testicular secretory protein Li 65; V-ATPase B2 subunit; V-ATPase subunit B 2; V-type proton ATPase subunit B, brain isoform; vacuolar H+-ATPase 56,000 subunit; Vacuolar proton pump subunit B 2
Gene Aliases: ATP6B1B2; ATP6B2; ATP6V1B2; DOOD; HO57; VATB; Vma2; VPP3; ZLS2
UniProt ID: (Human) P21281
Entrez Gene ID: (Human) 526
Molecular Function:
ATP synthase
DNA binding protein
anion channel
cation transporter
hydrolase
ion channel
ligand-gated ion channel
nucleic acid binding
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.