Novus Biologicals
Manufacturer Code:NBP233962
Catalog # NBP233962
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP6B158kD subunit ATPase H+ transporting lysosomal 56/58kDa V1 subunit B1 Endomembrane proton pump 58 kDa subunit H+-ATPase beta 1 subunit vacuolar proton pump 3 Vacuolar proton pump subunit B 1 vacuolar proton pump subunit 3 VATBMGC32642 V-ATPase B1 subunit V-ATPase subunit B 1 Vma2 V-type proton ATPase subunit B kidney isoform; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1; Endomembrane proton pump 58 kDa subunit; H(+)-transporting two-sector ATPase, 58kD subunit; H+-ATPase beta 1 subunit; V-ATPase B1 subunit; V-ATPase subunit B 1; V-type proton ATPase subunit B, kidney isoform; vacuolar proton pump 3; Vacuolar proton pump subunit B 1; vacuolar proton pump, subunit 3
Gene Aliases: ATP6B1; ATP6V1B1; RTA1B; VATB; VMA2; VPP3
UniProt ID: (Human) P15313
Entrez Gene ID: (Human) 525
Molecular Function:
ATP synthase
DNA binding protein
anion channel
cation transporter
hydrolase
ion channel
ligand-gated ion channel
nucleic acid binding
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.