Novus Biologicals
Manufacturer Code:NBP189330
Catalog # NBP189330
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A4 ATP6N2 ATP6V0 ATPase H+ transporting lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B ATPase H+ transporting lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD) ATPase H+ transporting lysosomal V0 subunit a4 MGC130016 MGC130017 noncatalytic accessory protein 1B RDRTA2 RTA1C RTADR STV1 vacuolar proton pump 116 kDa accessory subunit vacuolar proton pump subunit 2 vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform V-ATPase 116 kDa VPH1 VPP2 V-type proton ATPase 116 kDa subunit a V-type proton ATPase 116 kDa subunit a isoform 4; ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B; ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD); ATPase, H+ transporting, lysosomal V0 subunit a4; H(+)-transporting two-sector ATPase, noncatalytic accessory protein 1B; V-ATPase 116 kDa; V-ATPase 116 kDa isoform a4; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a isoform 4; vacuolar proton pump 116 kDa accessory subunit; vacuolar proton pump, subunit 2; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 4; Vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform
Gene Aliases: A4; ATP6N1B; ATP6N2; ATP6V0A4; RDRTA2; RTA1C; RTADR; STV1; VPH1; VPP2
UniProt ID: (Human) Q9HBG4
Entrez Gene ID: (Human) 50617
Molecular Function:
ATP synthase
cation transporter
hydrolase
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.