Novus Biologicals
Manufacturer Code:NBP159069
Catalog # NBP159069
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ATP6V0A2(ATPase H+ transporting lysosomal V0 subunit a2) The peptide sequence was selected from the N terminal of ATP6V0A2. Peptide sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A2 ARCL ATP6a2 ATP6N1D ATP6V0 ATPase H+ transporting lysosomal V0 subunit a isoform 2 ATPase H+ transporting lysosomal V0 subunit a2 infantile malignant osteopetrosis J6B7 Lysosomal H(+)-transporting ATPase V0 subunit a2 regeneration and tolerance factor RTF STV1 TJ6A2V-ATPase TJ6M TJ6S vacuolar proton translocating ATPase 116 kDa subunit a Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2 v-ATPase 116 kDa V-ATPase 116 kDa isoform a2 Vph1 v-type proton ATPase 116 kDa subunit a V-type proton ATPase 116 kDa subunit a isoform 2 WSS; A2V-ATPase; ATPase, H+ transporting, lysosomal V0 subunit a2; Lysosomal H(+)-transporting ATPase V0 subunit a2; regeneration and tolerance factor; TJ6; v-ATPase 116 kDa; V-ATPase 116 kDa subunit a2; v-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a2; vacuolar proton translocating ATPase 116 kDa subunit a; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2
Gene Aliases: A2; ARCL; ARCL2A; ATP6A2; ATP6N1D; ATP6V0A2; J6B7; RTF; STV1; TJ6; TJ6M; TJ6S; VPH1; WSS
UniProt ID: (Human) Q9Y487
Entrez Gene ID: (Human) 23545
Molecular Function: ATP synthase cation transporter hydrolase transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.