Novus Biologicals
Manufacturer Code:NBP159949
Catalog # NBP159949
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ATP6V0A1(ATPase H+ transporting lysosomal V0 subunit a1) The peptide sequence was selected from the N terminal of ATP6V0A1. Peptide sequence RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: a1 ATP6N1 ATP6N1AATPase H+ transporting lysosomal non-catalytic accessory protein 1(110/116kD) ATP6V0 ATPase H+ transporting lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD) ATPase H+ transporting lysosomal V0 subunit a isoform 1 ATPase H+ transporting lysosomal V0 subunit a1 Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit DKFZp781J1951 Stv1 Vacuolar adenosine triphosphatase subunit Ac116 Vacuolar proton pump subunit 1 vacuolar proton pump subunit 1 vacuolar proton translocating ATPase 116 kDa subunit A Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1 vacuolar-type H(+)-ATPase 115 kDa subunit V-ATPase 116 kDa V-ATPase 116 kDa isoform a1 Vph1 VPP1H(+)-transporting two-sector ATPase 116 kDa accessory protein A1 V-type proton ATPase 116 kDa subunit a V-type proton ATPase 116 kDa subunit a isoform 1; ATPase, H+ transporting, lysosomal non-catalytic accessory protein 1 (110/116kD); ATPase, H+ transporting, lysosomal V0 subunit a1; Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit; H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1; V-ATPase 116 kDa; V-ATPase 116 kDa subunit a1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a1; Vacuolar adenosine triphosphatase subunit Ac116; Vacuolar proton pump subunit 1; vacuolar proton translocating ATPase 116 kDa subunit A; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1; vacuolar-type H(+)-ATPase 115 kDa subunit
Gene Aliases: a1; ATP6N1; ATP6N1A; ATP6V0A1; Stv1; Vph1; VPP1
UniProt ID: (Human) Q93050
Entrez Gene ID: (Human) 535
Molecular Function:
ATP synthase
cation transporter
hydrolase
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.