Novus Biologicals
Manufacturer Code:NBP188889
Catalog # NBP188889
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP6Agastric H ATPase H+/K+ exchanging alpha polypeptide ATPase H+/K+ transporting alpha polypeptide EC 3.6.3 EC 3.6.3.10 gastric H Gastric H(+)/K(+) ATPase subunit alpha gastric H+/K+ ATPase alpha subunit gastric hydrogen-potassium ATPase H(+)-K(+)-ATPase alpha subunit K-ATPase alpha subunit K-ATPase catalytic subunit potassium-transporting ATPase alpha chain 1 Proton pump; ATPase, H+/K+ exchanging, alpha polypeptide; ATPase, H+/K+ transporting, alpha polypeptide; Gastric H(+)/K(+) ATPase subunit alpha; gastric H+/K+ ATPase alpha subunit; gastric H,K-ATPase alpha subunit; gastric H,K-ATPase catalytic subunit; gastric hydrogen-potassium ATPase; H(+)-K(+)-ATPase alpha subunit; Potassium-transporting ATPase alpha chain 1; Proton pump
Gene Aliases: ATP4A; ATP6A
UniProt ID: (Human) P20648
Entrez Gene ID: (Human) 495
Molecular Function:
cation transporter
hydrolase
ion channel
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.