Novus Biologicals
Manufacturer Code:NBP15986720UL
Catalog # NBP15986720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ATP1B4(ATPase (Na+)/K+ transporting beta 4 polypeptide) The peptide sequence was selected from the middle region of ATP1B4. Peptide sequence ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATPase (Na+)/K+ transporting beta 4 polypeptide ATPase Na+/K+ transporting beta 4 polypeptide K-ATPase beta-m subunit K-ATPase subunit beta-m protein ATP1B4 X X/potassium-transporting ATPase subunit beta-m; ATPase, Na+/K+ transporting, beta 4 polypeptide; BetaM; Na,K-ATPase beta m-subunit; Protein ATP1B4; X,K-ATPase beta-m subunit; X,K-ATPase subunit beta-m; X/potassium-transporting ATPase subunit beta-m
Gene Aliases: ATP1B4
UniProt ID: (Human) Q9UN42
Entrez Gene ID: (Human) 23439
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.