Novus Biologicals
Manufacturer Code:NBP159085
Catalog # NBP159085
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | A synthetic peptide directed towards the C terminal region of human ATG5. DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: APG5 autophagy 5-like (S. cerevisiae) APG5LS. cerevisiae)-like ASPAPG5-LIKE ATG5 autophagy related 5 homolog (S. cerevisiae) Autophagy protein 5; APG5-like; Apoptosis-specific protein; ATG5 autophagy related 5 homolog; Autophagy protein 5
Gene Aliases: APG5; APG5-LIKE; APG5L; ASP; ATG5; hAPG5
UniProt ID: (Human) Q9H1Y0
Entrez Gene ID: (Human) 9474
Molecular Function: membrane traffic protein membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.