Novus Biologicals
Manufacturer Code:NBP157650
Catalog # NBP157650
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C6ORF134 The peptide sequence was selected from the middle region of C6ORF134 (NP_079185). Peptide sequence DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acetyltransferase MEC-17 alpha tubulin acetyltransferase 1 alpha-TAT alpha-tubulin N-acetyltransferase C6orf134 chromosome 6 open reading frame 134 DKFZp547J097 EC 2.3.1.108 Em:AB023049.7 FLJ13158 MEC17Nbla00487 TAT; Acetyltransferase mec-17 homolog; Alpha-TAT; Alpha-tubulin N-acetyltransferase 1
Gene Aliases: alpha-TAT; alpha-TAT1; ATAT1; C6orf134; MEC17; Nbla00487; TAT
UniProt ID: (Human) Q5SQI0
Entrez Gene ID: (Human) 79969
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.