Novus Biologicals
Manufacturer Code:NBP17042720UL
Catalog # NBP17042720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C12ORF11 The peptide sequence was selected from the middle region of C12orf11. Peptide sequence VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ASUN asunder spermatogenesis regulator homolog (Drosphila) cell cycle regulator Mat89Bb homolog chromosome 12 open reading frame 11 FLJ10630 Mat89Bb NET48 SPATA30; asunder spermatogenesis regulator; asunder, spermatogenesis regulator homolog (Drosphila); Cell cycle regulator Mat89Bb homolog; Germ cell tumor 1; Integrator complex subunit 13; Protein asunder homolog; Sarcoma antigen NY-SAR-95; spermatogenesis associated 30
Gene Aliases: ASUN; C12orf11; GCT1; INTS13; Mat89Bb; NET48; SPATA30
UniProt ID: (Human) Q9NVM9
Entrez Gene ID: (Human) 55726
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.