Novus Biologicals
Manufacturer Code:NBP17954420UL
Catalog # NBP17954420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human Asrgl1The immunogen for this antibody is Asrgl1. Peptide sequence ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ALP1 ALPL-asparagine amidohydrolase asparaginase like 1 asparaginase-like 1 protein Asparaginase-like protein 1 CRASH EC 3.5.1.1 FLJ22316 L-asparaginase; asparaginase-like 1 protein; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; Isoaspartyl peptidase/L-asparaginase; Isoaspartyl peptidase/L-asparaginase alpha chain; Isoaspartyl peptidase/L-asparaginase beta chain; L-asparaginase; L-asparagine amidohydrolase; testis secretory sperm-binding protein Li 242mP
Gene Aliases: ALP; ALP1; ASRGL1; CRASH
UniProt ID: (Human) Q7L266
Entrez Gene ID: (Human) 80150
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.