Novus Biologicals
Manufacturer Code:NBP179797
Catalog # NBP179797
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human ASNA1The immunogen for this antibody is ASNA1. Peptide sequence: EARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ARSA arsA arsenite transporter ATP-binding homolog 1 (bacterial) ARSA1 ARSA-I Arsenical pump-driving ATPase Arsenite-stimulated ATPase ATPase ASNA1 EC 3.6 EC 3.6.3.16 GET3 golgi to ER traffic 3 homolog hARSA-I hASNA-I MGC3821 Transmembrane domain recognition complex 40 kDa ATPase subunit transmembrane domain recognition complex 40kDa TRC40arsA (bacterial) arsenite transporter ATP-binding homolog 1; Arsenical pump-driving ATPase; Arsenite-stimulated ATPase; ATPase GET3; Guided entry of tail-anchored proteins factor 3, ATPase; hARSA-I; hASNA-I; Transmembrane domain recognition complex 40 kDa ATPase subunit
Gene Aliases: ARSA; ARSA-I; ARSA1; ASNA-I; ASNA1; GET3; TRC40
UniProt ID: (Human) O43681
Entrez Gene ID: (Human) 439
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.