Novus Biologicals
Manufacturer Code:NBP15438520UL
Catalog # NBP15438520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ASGR1 (asialoglycoprotein receptor 1) The peptide sequence was selected from the N terminal of ASGR1. Peptide sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ASGP-R 1; ASGPR ASGPR 1 ASGP-R 1 asialoglycoprotein receptor 1 CLEC4H1ASGPR1 C-type lectin domain family 4 member H1 Hepatic lectin H1 HL-1; Asialoglycoprotein receptor 1; C-type lectin domain family 4 member H1; Hepatic lectin H1; HL-1
Gene Aliases: ASGPR; ASGPR1; ASGR1; CLEC4H1; HL-1
UniProt ID: (Human) P07306
Entrez Gene ID: (Human) 432
Molecular Function: cell adhesion molecule cytokine receptor defense/immunity protein immunoglobulin receptor superfamily receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.