Novus Biologicals
Manufacturer Code:NBP198485
Catalog # NBP198485
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is ARL1 - C-terminal region. Peptide sequence: SKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADP-ribosylation factor like GTPase 1; ADP-ribosylation factor-like 1; ADP-ribosylation factor-like 1 ADP-ribosylation factor-like protein 1 ARFL1; ADP-ribosylation factor-like protein 1
Gene Aliases: ARFL1; ARL1
UniProt ID: (Human) P40616
Entrez Gene ID: (Human) 400
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.