Novus Biologicals
Manufacturer Code:NBP15638020UL
Catalog # NBP15638020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to APOBEC4(apolipoprotein B mRNA editing enzyme catalytic polypeptide-like 4 (putative)) The peptide sequence was selected from the N terminal of APOBEC4. Peptide sequence LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4 (putative); apolipoprotein B mRNA editing enzyme catalytic polypeptide-like 4 (putative) Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 4 C1orf169 chromosome 1 open reading frame 169 EC 3.5.4.- FLJ25691 MGC26594 putative C->U-editing enzyme APOBEC-4 RP1-127C7.4; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative); Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 4; Putative C->U-editing enzyme APOBEC-4
Gene Aliases: APOBEC4; C1orf169
UniProt ID: (Human) Q8WW27
Entrez Gene ID: (Human) 403314
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.