Novus Biologicals
Manufacturer Code:NBP158955
Catalog # NBP158955
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to APOBEC3G (apolipoprotein B mRNA editing enzyme catalytic polypeptide-like 3G) The peptide sequence was selected from the N terminal of APOBEC3G. Peptide sequence AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A3G; APOBEC-related cytidine deaminase; APOBEC-related cytidine deaminase APOBEC-related protein APOBEC-related protein 9 apolipoprotein B mRNA editing enzyme catalytic polypeptide-like 3G ARCD ARP-9 bK150C2.7 CEM-15 CEM15ARP9 dJ494G10.1 DNA dC->dU-editing enzyme APOBEC-3G EC 3.5.4 EC 3.5.4.- EC 3.5.4.5 FLJ12740DNA dC->dU editing enzyme MDS019 phorbolin-like protein MDS019; APOBEC-related protein; APOBEC-related protein 9; apolipoprotein B editing enzyme catalytic polypeptide-like 3G; apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3G; apolipoprotein B mRNA editing enzyme cytidine deaminase; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G; apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3G; ARP-9; CEM-15; CEM15; Deoxycytidine deaminase; DNA dC->dU editing enzyme; DNA dC->dU-editing enzyme APOBEC-3G; phorbolin-like protein MDS019
Gene Aliases: A3G; APOBEC3G; ARCD; ARP-9; ARP9; bK150C2.7; CEM-15; CEM15; dJ494G10.1; MDS019
UniProt ID: (Human) Q9HC16
Entrez Gene ID: (Human) 60489
Molecular Function:
deaminase
hydrolase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.