Novus Biologicals
Manufacturer Code:NBP15726820UL
Catalog # NBP15726820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to APOBEC1(apolipoprotein B mRNA editing enzyme catalytic polypeptide 1) The peptide sequence was selected from the N terminal of APOBEC1. Peptide sequence TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APOBEC-1 apolipoprotein B mRNA editing enzyme catalytic polypeptide 1 Apolipoprotein B mRNA-editing enzyme 1 BEDPC->U-editing enzyme APOBEC-1 CDAR1 EC 3.5.4 EC 3.5.4.- HEPRapolipoprotein B mRNA editing enzyme complex-1; apolipoprotein B mRNA editing enzyme catalytic polypeptide 1; apolipoprotein B mRNA editing enzyme complex-1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; Apolipoprotein B mRNA-editing enzyme 1; C->U-editing enzyme APOBEC-1; HEPR; mRNA(cytosine(6666)) deaminase 1
Gene Aliases: APOBEC-1; APOBEC1; BEDP; CDAR1; HEPR
UniProt ID: (Human) P41238
Entrez Gene ID: (Human) 339
Molecular Function: deaminase hydrolase nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.